PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_021070-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 477aa    MW: 53039.5 Da    PI: 10.3208
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_021070-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding285e-09441240
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqc 40
                     +rW+t+E++ll  av ++G+ +W+++a++++  R l++c
    NNU_021070-RA  4 MRWSTWEELLLGGAVLRHGTQDWEAVAAELQ-ARILYSC 41
                     69*****************************.******9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF002491.1E-6441IPR001005SANT/Myb domain
CDDcd001670.00461555No hitNo description
SMARTSM002972.6E-1078367IPR001487Bromodomain
SuperFamilySSF473708.11E-16270364IPR001487Bromodomain
Gene3DG3DSA:1.20.920.104.3E-13272364IPR001487Bromodomain
PfamPF004395.6E-10273351IPR001487Bromodomain
PROSITE profilePS500149.159278348IPR001487Bromodomain
CDDcd043694.62E-14280362No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MAMMRWSTWE ELLLGGAVLR HGTQDWEAVA AELQARILYS CSFTAEICKA KYKDLQERYC  60
GCTSWFEELR KQRVAELKRE LENSLESKLE SLKAEREGRN TDSSSCRTES PATLGTSDGV  120
DFSGKETSSK DGLSAGSFTE ETTINWSSQC KGPAPVSAQQ ADIKPESVED SDRDKKSNFV  180
DKLEVTTVVA GRGGNLRKRR GKRKRKECSS NISRDVKEGS VAESDVMSSA NVIVAVPDKE  240
ESTRDCNGSA RPTDENDRND RNGGVGVADL IGIFNSVVEN DCASMFRRRL DSQRRSRYKQ  300
TVRQHLDFDT IRTRIIDHSI MSSKELFRDL LLLANNAAVF YPKNTRQHKS ALALRELAKK  360
TFQRQFLSDS GRETGSSATA NTDAALHVVE APRFNPPVKP RSIRPCNRKV IRKVNDLGKS  420
VPQNPSREGK KSSEAASQVE ASAVAKKSVG RPGKVGRRGS RKRPESQAKG RKKARRT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1198206RRGKRKRKE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010278331.10.0PREDICTED: uncharacterized protein LOC104612578 isoform X1
TrEMBLA0A061GG171e-135A0A061GG17_THECC; Bromodomain 4, putative
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42150.12e-16DNA-binding bromodomain-containing protein